Protein Info for b2392 in Escherichia coli BW25113

Name: mntH
Annotation: manganese transport protein MntH (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 237 to 263 (27 residues), see Phobius details amino acids 284 to 312 (29 residues), see Phobius details amino acids 325 to 343 (19 residues), see Phobius details amino acids 349 to 370 (22 residues), see Phobius details amino acids 390 to 410 (21 residues), see Phobius details TIGR01197: metal ion transporter, metal ion (Mn2+/Fe2+) transporter (Nramp) family" amino acids 19 to 377 (359 residues), 330.8 bits, see alignment E=7.3e-103 PF01566: Nramp" amino acids 38 to 384 (347 residues), 428.2 bits, see alignment E=1.3e-132

Best Hits

Swiss-Prot: 100% identical to MNTH_SHIBS: Divalent metal cation transporter MntH (mntH) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K03322, manganese transport protein (inferred from 100% identity to eco:b2392)

MetaCyc: 100% identical to Mn2+/Fe2+: H+ symporter MntH (Escherichia coli K-12 substr. MG1655)
RXN0-2421; TRANS-RXN-241

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A769 at UniProt or InterPro

Protein Sequence (412 amino acids)

>b2392 manganese transport protein MntH (NCBI) (Escherichia coli BW25113)
MTNYRVESSSGRAARKMRLALMGPAFIAAIGYIDPGNFATNIQAGASFGYQLLWVVVWAN
LMAMLIQILSAKLGIATGKNLAEQIRDHYPRPVVWFYWVQAEIIAMATDLAEFIGAAIGF
KLILGVSLLQGAVLTGIATFLILMLQRRGQKPLEKVIGGLLLFVAAAYIVELIFSQPNLA
QLGKGMVIPSLPTSEAVFLAAGVLGATIMPHVIYLHSSLTQHLHGGSRQQRYSATKWDVA
IAMTIAGFVNLAMMATAAAAFHFSGHTGVADLDEAYLTLQPLLSHAAATVFGLSLVAAGL
SSTVVGTLAGQVVMQGFIRFHIPLWVRRTVTMLPSFIVILMGLDPTRILVMSQVLLSFGI
ALALVPLLIFTSDSKLMGDLVNSKRVKQTGWVIVVLVVALNIWLLVGTALGL