Protein Info for b2346 in Escherichia coli BW25113

Name: vacJ
Annotation: predicted lipoprotein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 104 to 118 (15 residues), see Phobius details PF04333: MlaA" amino acids 29 to 222 (194 residues), 223.1 bits, see alignment E=1.4e-70

Best Hits

Swiss-Prot: 100% identical to MLAA_ECOLI: Intermembrane phospholipid transport system lipoprotein MlaA (mlaA) from Escherichia coli (strain K12)

KEGG orthology group: K04754, lipoprotein (inferred from 100% identity to eco:b2346)

Predicted SEED Role

"Lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76506 at UniProt or InterPro

Protein Sequence (251 amino acids)

>b2346 predicted lipoprotein (NCBI) (Escherichia coli BW25113)
MKLRLSALALGTTLLVGCASSGTDQQGRSDPLEGFNRTMYNFNFNVLDPYIVRPVAVAWR
DYVPQPARNGLSNFTGNLEEPAVMVNYFLQGDPYQGMVHFTRFFLNTILGMGGFIDVAGM
ANPKLQRTEPHRFGSTLGHYGVGYGPYVQLPFYGSFTLRDDGGDMADGFYPVLSWLTWPM
SVGKWTLEGIETRAQLLDSDGLLRQSSDPYIMVREAYFQRHDFIANGGELKPQENPNAQA
IQDDLKDIDSE