Protein Info for b2303 in Escherichia coli BW25113

Name: folX
Annotation: D-erythro-7,8-dihydroneopterin triphosphate 2'-epimerase and dihydroneopterin aldolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00526: FolB domain
  • amino acids 6 to 120 (115 residues), 132.9 bits, E=3.3e-43
• PF02152: FolB
  • amino acids 8 to 116 (109 residues), 91.6 bits, E=2.5e-30

Best Hits

Swiss-Prot: 100% identical to FOLX_ECOLI: Dihydroneopterin triphosphate 2'-epimerase (folX) from Escherichia coli (strain K12)

KEGG orthology group: K07589, D-erythro-7,8-dihydroneopterin triphosphate epimerase [EC: 5.-.-.-] (inferred from 100% identity to eco:b2303)

MetaCyc: 100% identical to dihydroneopterin triphosphate 2'-epimerase (Escherichia coli K-12 substr. MG1655)
H2NTPEPIM-RXN [EC: 5.1.99.7]

Predicted SEED Role

"Dihydroneopterin triphosphate epimerase" in subsystem Folate Biosynthesis

MetaCyc Pathways

• tetrahydromonapterin biosynthesis (3/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of steroids
• Carotenoid biosynthesis - General
• Lipopolysaccharide biosynthesis
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 5.-.-.- or 5.1.99.7

Sequence Analysis Tools

See P0AC19 at UniProt or InterPro

Protein Sequence (120 amino acids)

>b2303 D-erythro-7,8-dihydroneopterin triphosphate 2'-epimerase and dihydroneopterin aldolase (NCBI) (Escherichia coli BW25113)
MAQPAAIIRIKNLRLRTFIGIKEEEINNRQDIVINVTIHYPADKARTSEDINDALNYRTV
TKNIIQHVENNRFSLLEKLTQDVLDIAREHHWVTYAEVEIDKLHALRYADSVSMTLSWQR