Protein Info for b2243 in Escherichia coli BW25113

Name: glpC
Annotation: sn-glycerol-3-phosphate dehydrogenase (anaerobic), small subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03379: glycerol-3-phosphate dehydrogenase, anaerobic, C subunit
  • amino acids 3 to 395 (393 residues), 765.2 bits, E=6e-235
• PF13183: Fer4_8
  • amino acids 6 to 70 (65 residues), 44.8 bits, E=3.8e-15
• PF12838: Fer4_7
  • amino acids 8 to 70 (63 residues), 28.4 bits, E=4.6e-10
• PF13534: Fer4_17
  • amino acids 8 to 70 (63 residues), 31 bits, E=7.7e-11
• PF02754: CCG
  • amino acids 163 to 249 (87 residues), 57.3 bits, E=3.5e-19
  • amino acids 293 to 376 (84 residues), 58.4 bits, E=1.6e-19

Best Hits

Swiss-Prot: 100% identical to GLPC_ECOLI: Anaerobic glycerol-3-phosphate dehydrogenase subunit C (glpC) from Escherichia coli (strain K12)

KEGG orthology group: K00113, glycerol-3-phosphate dehydrogenase subunit C [EC: 1.1.5.3] (inferred from 100% identity to eco:b2243)

MetaCyc: 100% identical to anaerobic glycerol-3-phosphate dehydrogenase subunit C (Escherichia coli K-12 substr. MG1655)
Glycerol-3-phosphate dehydrogenase. [EC: 1.1.5.3]

Predicted SEED Role

"Anaerobic glycerol-3-phosphate dehydrogenase subunit C (EC 1.1.5.3)" in subsystem Respiratory dehydrogenases 1 (EC 1.1.5.3)

MetaCyc Pathways

• glycerol and glycerophosphodiester degradation (4/4 steps found)
• sn-glycerol 3-phosphate anaerobic respiration (3/3 steps found)
• glycerol degradation I (3/3 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• glycerol-3-phosphate to fumarate electron transfer (2/2 steps found)
• glycerol-3-phosphate to hydrogen peroxide electron transport (2/2 steps found)
• glycerophosphodiester degradation (2/2 steps found)
• nitrate reduction IX (dissimilatory) (2/2 steps found)
• glycerol 3-phosphate to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.5.3

Use Curated BLAST to search for 1.1.5.3

Sequence Analysis Tools

See P0A996 at UniProt or InterPro

Protein Sequence (396 amino acids)

>b2243 sn-glycerol-3-phosphate dehydrogenase (anaerobic), small subunit (NCBI) (Escherichia coli BW25113)
MNDTSFENCIKCTVCTTACPVSRVNPGYPGPKQAGPDGERLRLKDGALYDEALKYCINCK
RCEVACPSDVKIGDIIQRARAKYDTTRPSLRNFVLSHTDLMGSVSTPFAPIVNTATSLKP
VRQLLDAALKIDHRRTLPKYSFGTFRRWYRSVAAQQAQYKDQVAFFHGCFVNYNHPQLGK
DLIKVLNAMGTGVQLLSKEKCCGVPLIANGFTDKARKQAITNVESIREAVGVKGIPVIAT
SSTCTFALRDEYPEVLNVDNKGLRDHIELATRWLWRKLDEGKTLPLKPLPLKVVYHTPCH
MEKMGWTLYTLELLRNIPGLELTVLDSQCCGIAGTYGFKKENYPTSQAIGAPLFRQIEES
GADLVVTDCETCKWQIEMSTSLRCEHPITLLAQALA