Protein Info for b2168 in Escherichia coli BW25113

Name: fruK
Annotation: 1-phosphofructokinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03828: 1-phosphofructokinase
  • amino acids 5 to 308 (304 residues), 337 bits, E=8.6e-105
• TIGR03168: hexose kinase, 1-phosphofructokinase family
  • amino acids 5 to 308 (304 residues), 328.9 bits, E=2.4e-102
• PF00294: PfkB
  • amino acids 14 to 293 (280 residues), 244.4 bits, E=9.1e-77

Best Hits

Swiss-Prot: 100% identical to K1PF_ECOLI: 1-phosphofructokinase (fruK) from Escherichia coli (strain K12)

KEGG orthology group: K00882, 1-phosphofructokinase [EC: 2.7.1.56] (inferred from 100% identity to eco:b2168)

MetaCyc: 100% identical to 1-phosphofructokinase (Escherichia coli K-12 substr. MG1655)
1-phosphofructokinase. [EC: 2.7.1.56]

Predicted SEED Role

"1-phosphofructokinase (EC 2.7.1.56)" in subsystem Fructose utilization (EC 2.7.1.56)

MetaCyc Pathways

• superpathway of hexitol degradation (bacteria) (18/18 steps found)
• galactitol degradation (5/5 steps found)
• D-galactosamine and N-acetyl-D-galactosamine degradation (4/4 steps found)
• N-acetyl-D-galactosamine degradation (4/5 steps found)
• fructose degradation (1/1 steps found)
• lactose degradation I (2/5 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.56

Sequence Analysis Tools

See P0AEW9 at UniProt or InterPro

Protein Sequence (312 amino acids)

>b2168 1-phosphofructokinase (NCBI) (Escherichia coli BW25113)
MSRRVATITLNPAYDLVGFCPEIERGEVNLVKTTGLHAAGKGINVAKVLKDLGIDVTVGG
FLGKDNQDGFQQLFSELGIANRFQVVQGRTRINVKLTEKDGEVTDFNFSGFEVTPADWER
FVTDSLSWLGQFDMVCVSGSLPSGVSPEAFTDWMTRLRSQCPCIIFDSSREALVAGLKAA
PWLVKPNRRELEIWAGRKLPEMKDVIEAAHALREQGIAHVVISLGAEGALWVNASGEWIA
KPPSVDVVSTVGAGDSMVGGLIYGLLMRESSEHTLRLATAVAALAVSQSNVGITDRPQLA
AMMARVDLQPFN