Protein Info for b2144 in Escherichia coli BW25113

Name: sanA
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02698: DUF218" amino acids 47 to 174 (128 residues), 65.4 bits, see alignment E=2.5e-22

Best Hits

Swiss-Prot: 100% identical to SANA_SHIFL: Protein SanA (sanA) from Shigella flexneri

KEGG orthology group: K03748, SanA protein (inferred from 100% identity to eco:b2144)

Predicted SEED Role

"SanA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFY2 at UniProt or InterPro

Protein Sequence (239 amino acids)

>b2144 hypothetical protein (NCBI) (Escherichia coli BW25113)
MLKRVFLSLLVLIGLLLLTVLGLDRWMSWKTAPYIYDELQDLPYRQVGVVLGTAKYYRTG
VINQYYRYRIQGAINAYNSGKVNYLLLSGDNALQSYNEPMTMRKDLIAAGVDPSDIVLDY
AGFRTLDSIVRTRKVFDTNDFIIITQRFHCERALFIALHMGIQAQCYAVPSPKDMLSVRI
REFAARFGALADLYIFKREPRFLGPLVPIPAMHQVPEDAQGYPAVTPEQLLELQKKQGK