Protein Info for b2126 in Escherichia coli BW25113

Name: yehU
Annotation: predicted sensory kinase in two-component system with YehT (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 74 to 95 (22 residues), see Phobius details amino acids 105 to 129 (25 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 27 to 196 (170 residues), 197.6 bits, see alignment E=2.4e-62 PF13185: GAF_2" amino acids 243 to 352 (110 residues), 28.6 bits, see alignment E=3e-10 PF06580: His_kinase" amino acids 371 to 448 (78 residues), 92.8 bits, see alignment E=2.6e-30

Best Hits

Swiss-Prot: 100% identical to BTSS_ECOL6: Sensor histidine kinase BtsS (btsS) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02478, two-component system, LytT family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to eco:b2126)

MetaCyc: 100% identical to high-affinity pyruvate receptor (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Autolysis histidine kinase LytS" in subsystem Murein hydrolase regulation and cell death

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AD14 at UniProt or InterPro

Protein Sequence (561 amino acids)

>b2126 predicted sensory kinase in two-component system with YehT (NCBI) (Escherichia coli BW25113)
MYDFNLVLLLLQQMCVFLVIAWLMSKTPLFIPLMQVTVRLPHKFLCYIVFSIFCIMGTWF
GLHIDDSIANTRAIGAVMGGLLGGPVVGGLVGLTGGLHRYSMGGMTALSCMISTIVEGLL
GGLVHSILIRRGRTDKVFNPITAGAVTFVAEMVQMLIILAIARPYEDAVRLVSNIAAPMM
VTNTVGAALFMRILLDKRAMFEKYTSAFSATALKVAASTEGILRQGFNEVNSMKVAQVLY
QELDIGAVAITDREKLLAFTGIGDDHHLPGKPISSTYTLKAIETGEVVYADGNEVPYRCS
LHPQCKLGSTLVIPLRGENQRVMGTIKLYEAKNRLFSSINRTLGEGIAQLLSAQILAGQY
ERQKAMLTQSEIKLLHAQVNPHFLFNALNTIKAVIRRDSEQASQLVQYLSTFFRKNLKRP
SEFVTLADEIEHVNAYLQIEKARFQSRLQVNIAIPQELSQQQLPAFTLQPIVENAIKHGT
SQLLDTGRVAISARREGQHLMLEIEDNAGLYQPVTNASGLGMNLVDKRLRERFGDDYGIS
VACEPDSYTRITLRLPWRDEA