Protein Info for b2101 in Escherichia coli BW25113

Name: yegW
Annotation: predicted DNA-binding transcriptional regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF00392: GntR" amino acids 29 to 87 (59 residues), 58 bits, see alignment E=1.2e-19 PF07702: UTRA" amino acids 108 to 242 (135 residues), 124.3 bits, see alignment E=6.7e-40

Best Hits

Swiss-Prot: 100% identical to YEGW_ECO57: Uncharacterized HTH-type transcriptional regulator YegW (yegW) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b2101)

Predicted SEED Role

"Uncharacterized HTH-type transcriptional regulator YegW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACM5 at UniProt or InterPro

Protein Sequence (248 amino acids)

>b2101 predicted DNA-binding transcriptional regulator (NCBI) (Escherichia coli BW25113)
MEQAHTQLIAQLNERILAADNTPLYIKFAETVKNAVRSGVLEHGNILPGERDLSQLTGVS
RITVRKAMQALEEEGVVTRSRGYGTQINNIFEYSLKEARGFSQQVVLRGKKPDTLWVNKR
VVKCPEEVAQQLAVEAGSDVFLLKRIRYVDEEAVSIEESWVPAHLIHDVDAIGISLYDYF
RSQHIYPQRTRSRVSARMPDAEFQSHIQLDSKIPVLVIKQVALDQQQRPIEYSISHCRSD
LYVFVCEE