Protein Info for b2061 in Escherichia coli BW25113

Name: wzb
Annotation: protein-tyrosine phosphatase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF01451: LMWPc" amino acids 4 to 145 (142 residues), 171.3 bits, see alignment E=7.9e-55

Best Hits

Swiss-Prot: 100% identical to WZB_ECOLI: Low molecular weight protein-tyrosine-phosphatase Wzb (wzb) from Escherichia coli (strain K12)

KEGG orthology group: K01104, protein-tyrosine phosphatase [EC: 3.1.3.48] (inferred from 100% identity to eco:b2061)

MetaCyc: 100% identical to protein-tyrosine phosphatase (Escherichia coli K-12 substr. MG1655)
Protein-tyrosine-phosphatase. [EC: 3.1.3.48]

Predicted SEED Role

"Low molecular weight protein-tyrosine-phosphatase Wzb (EC 3.1.3.48)" in subsystem Colanic acid biosynthesis (EC 3.1.3.48)

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.48

Use Curated BLAST to search for 3.1.3.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AAB2 at UniProt or InterPro

Protein Sequence (147 amino acids)

>b2061 protein-tyrosine phosphatase (NCBI) (Escherichia coli BW25113)
MFNNILVVCVGNICRSPTAERLLQRYHPELKVESAGLGALVGKGADPTAISVAAEHQLSL
EGHCARQISRRLCRNYDLILTMEKRHIERLCEMAPEMRGKVMLFGHWDNECEIPDPYRKS
RETFAAVYTLLERSARQWAQALNAEQV