Protein Info for b2043 in Escherichia coli BW25113

Name: wcaM
Annotation: predicted colanic acid biosynthesis protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR04004: colanic acid biosynthesis protein WcaM" amino acids 3 to 461 (459 residues), 971.7 bits, see alignment E=2.5e-297 PF27800: WcaM" amino acids 4 to 461 (458 residues), 939.6 bits, see alignment E=1.3e-287

Best Hits

Swiss-Prot: 100% identical to WCAM_ECOLI: Colanic acid biosynthesis protein WcaM (wcaM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2043)

Predicted SEED Role

"Colanic acid biosynthesis protein wcaM"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P71244 at UniProt or InterPro

Protein Sequence (464 amino acids)

>b2043 predicted colanic acid biosynthesis protein (NCBI) (Escherichia coli BW25113)
MPFKKLSRRTFLTASSALAFLHTPFARALPARQSVNINDYNPHDWIASFKQAFSEGQTVV
VPAGLVCDNINTGIFIPPGKTLHILGSLRGNGRGRFVLQDGSQVTGEDGGSMHNITLDVR
GSDCTIKGLTMSGFGPVTQIYIGGKNKRVMRNLIIDNLTVSHANYAILRQGFHNQIIGAN
ITNCKFSDLQGDAIEWNVAINDRDILISDHVIERINCTNGKINWGIGIGLAGSTYDNNYP
EDQAVKNFVVANITGSDCRQLIHVENGKHFVIRNIKARNITPDFSKKAGIDNATVAIYGC
DNFVIDNIEMINSAGMLIGYGVIKGKYLSIPQNFRVNDIQLDNTHLAYKLRGIQISAGNA
VSFVALTNIEMKRASLELHNKPQHFFMRNINVMQESSVGPALSMNFDMRKDVRGVFMAKK
ETLLSLANVHAVNEKGQSSVDIDRINHHIVNVEKINFRLPELRE