Protein Info for b2040 in Escherichia coli BW25113

Name: rfbD
Annotation: dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of dTDP-L-rhamnose synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 1 to 293 (293 residues), 364.8 bits, E=6.8e-113
• TIGR01214: dTDP-4-dehydrorhamnose reductase
  • amino acids 3 to 292 (290 residues), 327.7 bits, E=2.6e-102
• PF02719: Polysacc_synt_2
  • amino acids 3 to 153 (151 residues), 30.8 bits, E=4.3e-11
• PF01370: Epimerase
  • amino acids 3 to 179 (177 residues), 62.5 bits, E=1.1e-20
• PF16363: GDP_Man_Dehyd
  • amino acids 38 to 151 (114 residues), 43.8 bits, E=6.3e-15
• PF07993: NAD_binding_4
  • amino acids 55 to 156 (102 residues), 22.3 bits, E=1.7e-08

Best Hits

Swiss-Prot: 100% identical to RMLD_ECOLI: dTDP-4-dehydrorhamnose reductase (rfbD) from Escherichia coli (strain K12)

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 100% identity to eco:b2040)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (7/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (14/33 steps found)

KEGG Metabolic Maps

• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

See P37760 at UniProt or InterPro

Protein Sequence (299 amino acids)

>b2040 dTDP-4-dehydrorhamnose reductase subunit, NAD(P)-binding, of dTDP-L-rhamnose synthase (NCBI) (Escherichia coli BW25113)
MNILLFGKTGQVGWELQRALAPLGNLIAFDVHSTDYCGDFSNPEGVAETVRSIRPDIIVN
AAAHTAVDKAESEPEFAQLINATSVEAIAKAANEVGAWVIHYSTDYVFPGNGDMPWLETD
ATAPLNVYGETKLAGEKALQEYCAKHLIFRTSWVYAGKGNNFAKTMLRLAKEREELAVIN
DQFGAPTGAELLADCTAHAIRVALNKPDVAGLYHLVASGTTTWYDYAALVFEEARKAGIP
LALNKLNAVPTTAYPTPARRPHNSRLNTEKFQQNFALVLPDWQVGVKRMLNELFTTTAI