Protein Info for b2029 in Escherichia coli BW25113

Name: gnd
Annotation: 6-phosphogluconate dehydrogenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 PF03446: NAD_binding_2" amino acids 5 to 174 (170 residues), 170.7 bits, see alignment E=2.6e-54 TIGR00873: 6-phosphogluconate dehydrogenase (decarboxylating)" amino acids 5 to 467 (463 residues), 770.9 bits, see alignment E=2.4e-236 PF00393: 6PGD" amino acids 179 to 466 (288 residues), 452.9 bits, see alignment E=5.1e-140

Best Hits

Swiss-Prot: 100% identical to 6PGD_ECOLI: 6-phosphogluconate dehydrogenase, decarboxylating (gnd) from Escherichia coli (strain K12)

KEGG orthology group: K00033, 6-phosphogluconate dehydrogenase [EC: 1.1.1.44] (inferred from 100% identity to eco:b2029)

MetaCyc: 100% identical to 6-phosphogluconate dehydrogenase, decarboxylating (Escherichia coli K-12 substr. MG1655)
Phosphogluconate dehydrogenase (decarboxylating). [EC: 1.1.1.44]

Predicted SEED Role

"6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)" in subsystem Pentose phosphate pathway (EC 1.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P00350 at UniProt or InterPro

Protein Sequence (468 amino acids)

>b2029 6-phosphogluconate dehydrogenase (NCBI) (Escherichia coli BW25113)
MSKQQIGVVGMAVMGRNLALNIESRGYTVSIFNRSREKTEEVIAENPGKKLVPYYTVKEF
VESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGF
NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGH
YVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFT
KKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKDQRVAAS
KVLSGPQAQPAGDKAEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIF
RAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPT
FSAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLD