Protein Info for b1969 in Escherichia coli BW25113

Name: yedW
Annotation: putative 2-component transcriptional regulator (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 TIGR01387: heavy metal response regulator" amino acids 3 to 218 (216 residues), 383.3 bits, see alignment E=1.6e-119 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 96.5 bits, see alignment E=1.1e-31 PF00486: Trans_reg_C" amino acids 146 to 218 (73 residues), 86.5 bits, see alignment E=1e-28

Best Hits

Swiss-Prot: 100% identical to HPRR_ECOLI: Transcriptional regulatory protein HprR (hprR) from Escherichia coli (strain K12)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 100% identity to eco:b1969)

Predicted SEED Role

"Putative two-component system response regulator YedW" in subsystem Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76340 at UniProt or InterPro

Protein Sequence (223 amino acids)

>b1969 putative 2-component transcriptional regulator (VIMSS) (Escherichia coli BW25113)
MKILLIEDNQRTQEWVTQGLSEAGYVIDAVSDGRDGLYLALKDDYALIILDIMLPGMDGW
QILQTLRTAKQTPVICLTARDSVDDRVRGLDSGANDYLVKPFSFSELLARVRAQLRQHHA
LNSTLEISGLRMDSVSHSVSRDNISITLTRKEFQLLWLLASRAGEIIPRTVIASEIWGIN
FDSDTNTVDVAIRRLRAKVDDPFPEKLIATIRGMGYSFVAVKK