Protein Info for b1896 in Escherichia coli BW25113

Name: otsA
Annotation: trehalose-6-phosphate synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 TIGR02400: alpha,alpha-trehalose-phosphate synthase (UDP-forming)" amino acids 3 to 453 (451 residues), 610.2 bits, see alignment E=1.1e-187 PF00982: Glyco_transf_20" amino acids 17 to 453 (437 residues), 518.6 bits, see alignment E=8e-160

Best Hits

Swiss-Prot: 100% identical to OTSA_ECODH: Trehalose-6-phosphate synthase (otsA) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K00697, alpha,alpha-trehalose-phosphate synthase (UDP-forming) [EC: 2.4.1.15] (inferred from 100% identity to eco:b1896)

MetaCyc: 100% identical to trehalose-6-phosphate synthase (Escherichia coli K-12 substr. MG1655)
Alpha,alpha-trehalose-phosphate synthase (UDP-forming). [EC: 2.4.1.15]

Predicted SEED Role

"Alpha,alpha-trehalose-phosphate synthase [UDP-forming] (EC 2.4.1.15)" in subsystem Trehalose Biosynthesis (EC 2.4.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P31677 at UniProt or InterPro

Protein Sequence (474 amino acids)

>b1896 trehalose-6-phosphate synthase (NCBI) (Escherichia coli BW25113)
MSRLVVVSNRIAPPDEHAASAGGLAVGILGALKAAGGLWFGWSGETGNEDQPLKKVKKGN
ITWASFNLSEQDLDEYYNQFSNAVLWPAFHYRLDLVQFQRPAWDGYLRVNALLADKLLPL
LQDDDIIWIHDYHLLPFAHELRKRGVNNRIGFFLHIPFPTPEIFNALPTYDTLLEQLCDY
DLLGFQTENDRLAFLDCLSNLTRVTTRSAKSHTAWGKAFRTEVYPIGIEPKEIAKQAAGP
LPPKLAQLKAELKNVQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQIAPTS
RGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLYYLNQHFDRKLLMKIFRYSDVGLVTPL
RDGMNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAALDRALTMS
LAERISRHAEMLDVIVKNDINHWQECFISDLKQIVPRSAESQQRDKVATFPKLA