Protein Info for b1873 in Escherichia coli BW25113

Name: torY
Annotation: TMAO reductase III (TorYZ), cytochrome c-type subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF03264: Cytochrom_NNT" amino acids 7 to 174 (168 residues), 228.7 bits, see alignment E=8.2e-72

Best Hits

Swiss-Prot: 100% identical to TORY_ECOLI: Cytochrome c-type protein TorY (torY) from Escherichia coli (strain K12)

KEGG orthology group: K07821, trimethylamine-N-oxide reductase (cytochrome c) 2, cytochrome c-type subunit TorY (inferred from 100% identity to eco:b1873)

Predicted SEED Role

"Cytochrome c-type protein TorY" in subsystem trimethylamine N-oxide (TMAO) reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P52005 at UniProt or InterPro

Protein Sequence (366 amino acids)

>b1873 TMAO reductase III (TorYZ), cytochrome c-type subunit (NCBI) (Escherichia coli BW25113)
MRGKKRIGLLFLLIAVVVGGGGLLLAQKVLHKTSDTAFCLSCHSMSKPFEEYQGTVHFSN
QKGIRAECADCHIPKSGMDYLFAKLKASKDIYHEFVSGKIDSDDKFEAHRQEMAETVWKE
LKATDSATCRSCHSFDAMDIASQSESAQKMHNKAQKDSETCIDCHKGIAHFPPEIKMDDN
AAHELESQAATSVTNGAHIYPFKTSHIGELATVNPGTDLTVVDASGKQPIVLLQGYQMQG
SENTLYLAAGQRLALATLSEEGIKALTVNGEWQADEYGNQWRQASLQGALTDPALADRKP
LWQYAEKLDDTYCAGCHAPIAADHYTVNAWPSIAKGMGARTSMSENELDILTRYFQYNAK
DITEKQ