Protein Info for b1853 in Escherichia coli BW25113

Name: yebK
Annotation: predicted DNA-binding transcriptional regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF01418: HTH_6" amino acids 1 to 76 (76 residues), 112.5 bits, see alignment E=1.2e-36 PF01380: SIS" amino acids 125 to 252 (128 residues), 104.5 bits, see alignment E=5.5e-34 PF13580: SIS_2" amino acids 171 to 210 (40 residues), 29.7 bits, see alignment 9.2e-11

Best Hits

Swiss-Prot: 100% identical to HEXR_ECOLI: HTH-type transcriptional regulator HexR (hexR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1853)

Predicted SEED Role

"Phosphogluconate repressor HexR, RpiR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P46118 at UniProt or InterPro

Protein Sequence (289 amino acids)

>b1853 predicted DNA-binding transcriptional regulator (NCBI) (Escherichia coli BW25113)
MNMLEKIQSQLEHLSKSERKVAEVILASPDNAIHSSIAAMALEANVSEPTVNRFCRSMDT
RGFPDFKLHLAQSLANGTPYVNRNVNEDDSVESYTGKIFESAMATLDHVRHSLDKSAINR
AVDLLTQAKKIAFFGLGSSAAVAHDAMNKFFRFNVPVVYSDDIVLQRMSCMNCSDGDVVV
LISHTGRTKNLVELAQLARENDAMVIALTSAGTPLAREATLAITLDVPEDTDIYMPMVSR
LAQLTVIDVLATGFTLRRGAKFRDNLKRVKEALKESRFDKQLLNLSDDR