Protein Info for b1835 in Escherichia coli BW25113

Name: yebU
Annotation: putative nucleolar proteins (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 PF17125: Methyltr_RsmF_N" amino acids 8 to 102 (95 residues), 97.7 bits, see alignment E=1.1e-31 PF22458: RsmF-B_ferredox" amino acids 9 to 78 (70 residues), 27.5 bits, see alignment E=7.3e-10 TIGR00446: NOL1/NOP2/sun family putative RNA methylase" amino acids 41 to 310 (270 residues), 392 bits, see alignment E=5.9e-122 PF01189: Methyltr_RsmB-F" amino acids 118 to 309 (192 residues), 155.5 bits, see alignment E=3.7e-49 PF21150: YebU_pre-PUA_dom" amino acids 329 to 405 (77 residues), 126.8 bits, see alignment E=6.1e-41 PF13636: Methyltranf_PUA" amino acids 421 to 470 (50 residues), 47.7 bits, see alignment 3.1e-16

Best Hits

Swiss-Prot: 100% identical to RSMF_ECOBW: Ribosomal RNA small subunit methyltransferase F (rsmF) from Escherichia coli (strain K12 / MC4100 / BW2952)

KEGG orthology group: K11392, ribosomal RNA small subunit methyltransferase F [EC: 2.1.1.-] (inferred from 100% identity to eco:b1835)

MetaCyc: 100% identical to 16S rRNA m5C1407 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11593 [EC: 2.1.1.178]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase F (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.178

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76273 at UniProt or InterPro

Protein Sequence (479 amino acids)

>b1835 putative nucleolar proteins (VIMSS) (Escherichia coli BW25113)
MAQHTVYFPDAFLTQMREAMPSTLSFDDFLAACQRPLRRSIRVNTLKISVADFLQLTAPY
GWTLTPIPWCEEGFWIERDNEDALPLGSTAEHLSGLFYIQEASSMLPVAALFADGNAPQR
VMDVAAAPGSKTTQISARMNNEGAILANEFSASRVKVLHANISRCGISNVALTHFDGRVF
GAAVPEMFDAILLDAPCSGEGVVRKDPDALKNWSPESNQEIAATQRELIDSAFHALRPGG
TLVYSTCTLNQEENEAVCLWLKETYPDAVEFLPLGDLFPGANKALTEEGFLHVFPQIYDC
EGFFVARLRKTQAIPALPAPKYKVGNFPFSPVKDREAGQIRQAATGVGLNWDENLRLWQR
DKELWLFPVGIEALIGKVRFSRLGIKLAETHNKGYRWQHEAVIALASPDNMNAFELTPQE
AEEWYRGRDVYPQAAPVADDVLVTFQHQPIGLAKRIGSRLKNSYPRELVRDGKLFTGNA