Protein Info for b1813 in Escherichia coli BW25113

Name: yeaB
Annotation: predicted NUDIX hydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 192 PF00293: NUDIX" amino acids 30 to 145 (116 residues), 58.2 bits, see alignment E=4.5e-20

Best Hits

Swiss-Prot: 100% identical to NUDL_ECODH: Uncharacterized Nudix hydrolase NudL (nudL) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: None (inferred from 100% identity to eco:b1813)

MetaCyc: 100% identical to putative NUDIX hydrolase with low 3-phosphohydroxypyruvate phosphatase activity (Escherichia coli K-12 substr. MG1655)
RXN0-6562

Predicted SEED Role

"Hypothetical nudix hydrolase YeaB" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P43337 at UniProt or InterPro

Protein Sequence (192 amino acids)

>b1813 predicted NUDIX hydrolase (NCBI) (Escherichia coli BW25113)
MEYRSLTLDDFLSRFQLLRPQINRETLNHRQAAVLIPIVRRPQPGLLLTQRSIHLRKHAG
QVAFPGGAVDDTDASAIAAALREAEEEVAIPPSAVEVIGVLPPVDSVTGYQVTPVVGIIP
PDLPYRASEDEVSAVFEMPLAQALHLGRYHPLDIYRRGDSHRVWLSWYEQYFVWGMTAGI
IRELALQIGVKP