Protein Info for b1740 in Escherichia coli BW25113

Name: nadE
Annotation: NAD synthetase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 275 TIGR00552: NAD+ synthetase" amino acids 16 to 275 (260 residues), 291.8 bits, see alignment E=1.8e-91 PF02540: NAD_synthase" amino acids 23 to 265 (243 residues), 262.6 bits, see alignment E=1.3e-82

Best Hits

Swiss-Prot: 100% identical to NADE_ECODH: NH(3)-dependent NAD(+) synthetase (nadE) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K01916, NAD+ synthase [EC: 6.3.1.5] (inferred from 100% identity to eco:b1740)

MetaCyc: 100% identical to NH3-dependent NAD+ synthetase (Escherichia coli K-12 substr. MG1655)
NAD(+) synthase. [EC: 6.3.1.5]

Predicted SEED Role

"NAD synthetase (EC 6.3.1.5)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 6.3.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P18843 at UniProt or InterPro

Protein Sequence (275 amino acids)

>b1740 NAD synthetase (NCBI) (Escherichia coli BW25113)
MTLQQQIIKALGAKPQINAEEEIRRSVDFLKSYLQTYPFIKSLVLGISGGQDSTLAGKLC
QMAINELRLETGNESLQFIAVRLPYGVQADEQDCQDAIAFIQPDRVLTVNIKGAVLASEQ
ALREAGIELSDFVRGNEKARERMKAQYSIAGMTSGVVVGTDHAAEAITGFFTKYGDGGTD
INPLYRLNKRQGKQLLAALACPEHLYKKAPTADLEDDRPSLPDEVALGVTYDNIDDYLEG
KNVPQQVARTIENWYLKTEHKRRPPITVFDDFWKK