Protein Info for b1735 in Escherichia coli BW25113

Name: chbR
Annotation: DNA-binding transcriptional dual regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF07883: Cupin_2" amino acids 28 to 81 (54 residues), 33.4 bits, see alignment E=5.9e-12 PF02311: AraC_binding" amino acids 38 to 81 (44 residues), 21.5 bits, see alignment 3.4e-08 PF12833: HTH_18" amino acids 202 to 273 (72 residues), 71.2 bits, see alignment E=1.4e-23 PF00165: HTH_AraC" amino acids 234 to 273 (40 residues), 43.7 bits, see alignment 4.4e-15

Best Hits

Swiss-Prot: 100% identical to CHBR_ECOLI: HTH-type transcriptional regulator ChbR (chbR) from Escherichia coli (strain K12)

KEGG orthology group: K03490, AraC family transcriptional regulator, cel operon repressor (inferred from 100% identity to eco:b1735)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P17410 at UniProt or InterPro

Protein Sequence (280 amino acids)

>b1735 DNA-binding transcriptional dual regulator (NCBI) (Escherichia coli BW25113)
MMQPVINAPEIATAREQQLFNGKNFHVFIYNKTESISGLHQHDYYEFTLVLTGRYFQEIN
GKRVLLERGDFVFIPLGSHHQSFYEFGATRILNVGISKRFFEQHYLPLLPYCFVASQVYR
TNNAFLTYVETVISSLNFRETGLEEFVEMVTFYVINRLRHYREEQVIDDVPQWLKSTVEK
MHDKEQFSESALENMVALSAKSQEYLTRATQRYYGKTPMQIINEIRINFAKKQLEMTNYS
VTDIAFEAGYSSPSLFIKTFKKLTSFTPKSYRKKLTEFNQ