Protein Info for b1711 in Escherichia coli BW25113

Name: btuC
Annotation: vtamin B12-transporter permease (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 58 to 81 (24 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 133 (19 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details amino acids 238 to 263 (26 residues), see Phobius details amino acids 274 to 297 (24 residues), see Phobius details amino acids 303 to 322 (20 residues), see Phobius details PF01032: FecCD" amino acids 22 to 323 (302 residues), 293.1 bits, see alignment E=2.2e-91 PF00950: ABC-3" amino acids 116 to 260 (145 residues), 21.6 bits, see alignment E=1.4e-08

Best Hits

Swiss-Prot: 100% identical to BTUC_ECOUT: Vitamin B12 import system permease protein BtuC (btuC) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: K06073, vitamin B12 transport system permease protein (inferred from 100% identity to eco:b1711)

MetaCyc: 100% identical to vitamin B12 ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-5-RXN [EC: 7.6.2.8]; 7.6.2.8 [EC: 7.6.2.8]

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P06609 at UniProt or InterPro

Protein Sequence (326 amino acids)

>b1711 vtamin B12-transporter permease (NCBI) (Escherichia coli BW25113)
MLTLARQQQRQNIRWLLCLSVLMLLALLLSLCAGEQWISPGDWFTPRGELFVWQIRLPRT
LAVLLVGAALAISGAVMQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPNWALGLC
AIAGALIITLILLRFARRHLSTSRLLLAGVALGIICSALMTWAIYFSTSVDLRQLMYWMM
GGFGGVDWRQSWLMLALIPVLLWICCQSRPMNMLALGEISARQLGLPLWFWRNVLVAATG
WMVGVSVALAGAIGFIGLVIPHILRLCGLTDHRVLLPGCALAGASALLLADIVARLALAA
AELPIGVVTATLGAPVFIWLLLKAGR