Protein Info for b1692 in Escherichia coli BW25113

Name: ydiB
Annotation: quinate/shikimate 5-dehydrogenase, NAD(P)-binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08501: Shikimate_dh_N
  • amino acids 12 to 94 (83 residues), 96.1 bits, E=1.2e-31
• PF18317: SDH_C
  • amino acids 255 to 283 (29 residues), 44.4 bits, see alignment (E = 1.1e-15)

Best Hits

Swiss-Prot: 100% identical to YDIB_ECO81: Quinate/shikimate dehydrogenase (ydiB) from Escherichia coli O81 (strain ED1a)

KEGG orthology group: K05887, quinate/shikimate dehydrogenase [EC: 1.1.1.282] (inferred from 100% identity to eco:b1692)

MetaCyc: 100% identical to quinate/shikimate dehydrogenase (Escherichia coli K-12 substr. MG1655)
Quinate/shikimate dehydrogenase. [EC: 1.1.1.282]; 1.1.1.282 [EC: 1.1.1.282]

Predicted SEED Role

"Shikimate/quinate 5-dehydrogenase I beta (EC 1.1.1.282)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 1.1.1.282)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• quinate degradation II (2/3 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.282

Sequence Analysis Tools

See P0A6D5 at UniProt or InterPro

Protein Sequence (288 amino acids)

>b1692 quinate/shikimate 5-dehydrogenase, NAD(P)-binding (NCBI) (Escherichia coli BW25113)
MDVTAKYELIGLMAYPIRHSLSPEMQNKALEKAGLPFTYMAFEVDNDSFPGAIEGLKALK
MRGTGVSMPNKQLACEYVDELTPAAKLVGAINTIVNDDGYLRGYNTDGTGHIRAIKESGF
DIKGKTMVLLGAGGASTAIGAQGAIEGLKEIKLFNRRDEFFDKALAFAQRVNENTDCVVT
VTDLADQQAFAEALASADILTNGTKVGMKPLENESLVNDISLLHPGLLVTECVYNPHMTK
LLQQAQQAGCKTIDGYGMLLWQGAEQFTLWTGKDFPLEYVKQVMGFGA