Protein Info for b1636 in Escherichia coli BW25113

Name: pdxY
Annotation: pyridoxine kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR00687: pyridoxal kinase" amino acids 1 to 286 (286 residues), 484.8 bits, see alignment E=4.5e-150 PF08543: Phos_pyr_kin" amino acids 72 to 257 (186 residues), 57.8 bits, see alignment E=1.1e-19 PF00294: PfkB" amino acids 132 to 249 (118 residues), 37.7 bits, see alignment E=1.5e-13

Best Hits

Swiss-Prot: 100% identical to PDXY_ECOLI: Pyridoxal kinase PdxY (pdxY) from Escherichia coli (strain K12)

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 100% identity to eco:b1636)

MetaCyc: 100% identical to pyridoxal kinase 2 (Escherichia coli K-12 substr. MG1655)
Pyridoxal kinase. [EC: 2.7.1.35]

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.35

Use Curated BLAST to search for 2.7.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77150 at UniProt or InterPro

Protein Sequence (287 amino acids)

>b1636 pyridoxine kinase (NCBI) (Escherichia coli BW25113)
MMKNILAIQSHVVYGHAGNSAAEFPMRRLGANVWPLNTVQFSNHTQYGKWTGCVMPPSHL
TEIVQGIAAIDKLHTCDAVLSGYLGSAEQGEHILGIVRQVKAANPQAKYFCDPVMGHPEK
GCIVAPGVAEFHVRHGLPASDIIAPNLVELEILCEHAVNNVEEAVLAARELIAQGPQIVL
VKHLARAGYSRDRFEMLLVTADEAWHISRPLVDFGMRQPVGVGDVTSGLLLVKLLQGATL
QEALEHVTAAVYEIMVTTKAMQEYELQVVAAQDRIAKPEHYFSATKL