Protein Info for b1626 in Escherichia coli BW25113

Name: b1626
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details PF10754: DUF2569" amino acids 6 to 144 (139 residues), 135.6 bits, see alignment E=8.8e-44

Best Hits

Swiss-Prot: 100% identical to YDGK_ECOLI: Inner membrane protein YdgK (ydgK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1626)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76180 at UniProt or InterPro

Protein Sequence (146 amino acids)

>b1626 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MTTTTPQRIGGWLLGPLAWLLVALLSTTLALLLYTAALSSPQTFQTLGGQALTTQILWGV
SFITAIALWYYTLWLTIAFFKRRRCVPKHYIIWLLISVLLAVKAFAFSPVEDGIAVRQLL
FTLLATALIVPYFKRSSRVKATFVNP