Protein Info for b1598 in Escherichia coli BW25113

Name: ydgD
Annotation: predicted peptidase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00089: Trypsin" amino acids 50 to 244 (195 residues), 38.8 bits, see alignment E=9.7e-14 PF13365: Trypsin_2" amino acids 69 to 240 (172 residues), 36 bits, see alignment E=1.2e-12

Best Hits

Swiss-Prot: 100% identical to YDGD_ECOLI: Uncharacterized serine protease YdgD (ydgD) from Escherichia coli (strain K12)

KEGG orthology group: K04775, protease YdgD [EC: 3.4.21.-] (inferred from 100% identity to eco:b1598)

Predicted SEED Role

"FIG00634494: possible peptidase"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76176 at UniProt or InterPro

Protein Sequence (273 amino acids)

>b1598 predicted peptidase (NCBI) (Escherichia coli BW25113)
MRTTIAVVLGAISLTSAFVFADKPDVARSANDEVSTLFFGHDDRVPVNDTTQSPWDAVGQ
LETASGNLCTATLIAPNLALTAGHCLLTPPKGKADKAVALRFVSNKGLWRYEIHDIEGRV
DPTLGKRLKADGDGWIVPPAAAPWDFGLIVLRNPPSGITPLPLFEGDKAALTAALKAAGR
KVTQAGYPEDHLDTLYSHQNCEVTGWAQTSVMSHQCDTLPGDSGSPLMLHTDDGWQLIGV
QSSAPAAKDRWRADNRAISVTGFRDKLDQLSQK