Protein Info for b1564 in Escherichia coli BW25113

Name: relB
Annotation: Qin prophage; bifunctional antitoxin of the RelE-RelB toxin-antitoxin system/ transcriptional repressor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 79 PF04221: RelB" amino acids 1 to 79 (79 residues), 112.2 bits, see alignment E=4.6e-37 TIGR02384: addiction module antitoxin, RelB/DinJ family" amino acids 3 to 79 (77 residues), 77.6 bits, see alignment E=3.3e-26

Best Hits

Swiss-Prot: 100% identical to RELB_SHIFL: Antitoxin RelB (relB) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b1564)

MetaCyc: 100% identical to Qin prophage; antitoxin/DNA-binding transcriptional repressor RelB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0C079 at UniProt or InterPro

Protein Sequence (79 amino acids)

>b1564 Qin prophage; bifunctional antitoxin of the RelE-RelB toxin-antitoxin system/ transcriptional repressor (NCBI) (Escherichia coli BW25113)
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVE
IVKERLRNPKPVRVTLDEL