Protein Info for b1517 in Escherichia coli BW25113
Name: lsrF
Annotation: hypothetical protein (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to LSRF_ECODH: 3-hydroxy-5-phosphonooxypentane-2,4-dione thiolase (lsrF) from Escherichia coli (strain K12 / DH10B)
KEGG orthology group: K08321, putative autoinducer-2 (AI-2) aldolase [EC: 4.1.2.-] (inferred from 100% identity to eco:b1517)MetaCyc: 100% identical to 3-hydroxy-2,4-pentadione 5-phosphate thiolase (Escherichia coli K-12 substr. MG1655)
RXN-15943 [EC: 2.3.1.245]
Predicted SEED Role
"Autoinducer 2 (AI-2) aldolase LsrF (EC 4.2.1.-)" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon) (EC 4.2.1.-)
MetaCyc Pathways
- autoinducer AI-2 degradation (3/3 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Fatty acid biosynthesis
- Fructose and mannose metabolism
- Limonene and pinene degradation
- Lysine degradation
- Naphthalene and anthracene degradation
- Nucleotide sugars metabolism
- Pentose phosphate pathway
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Porphyrin and chlorophyll metabolism
- Tyrosine metabolism
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 4.1.2.-, 4.2.1.-
Use Curated BLAST to search for 2.3.1.245 or 4.1.2.- or 4.2.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P76143 at UniProt or InterPro
Protein Sequence (291 amino acids)
>b1517 hypothetical protein (NCBI) (Escherichia coli BW25113) MADLDDIKDGKDFRTDQPQKNIPFTLKGCGALDWGMQSRLSRIFNPKTGKTVMLAFDHGY FQGPTTGLERIDINIAPLFEHADVLMCTRGILRSVVPPATNRPVVLRASGANSILAELSN EAVALSMDDAVRLNSCAVAAQVYIGSEYEHQSIKNIIQLVDAGMKVGMPTMAVTGVGKDM VRDQRYFSLATRIAAEMGAQIIKTYYVEKGFERIVAGCPVPIVIAGGKKLPEREALEMCW QAIDQGASGVDMGRNIFQSDHPVAMMKAVQAVVHHNETADRAYELYLSEKQ