Protein Info for b1496 in Escherichia coli BW25113

Name: yddA
Annotation: fused predicted multidrug transporter subunits of ABC superfamily: membrane component/ATP-binding component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 31 to 51 (21 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 28 to 301 (274 residues), 149.3 bits, see alignment E=2.2e-47 PF05992: SbmA_BacA" amino acids 33 to 350 (318 residues), 116.9 bits, see alignment E=1.9e-37 PF00005: ABC_tran" amino acids 383 to 515 (133 residues), 67.3 bits, see alignment E=3.4e-22

Best Hits

Swiss-Prot: 100% identical to YDDA_ECOLI: Inner membrane ABC transporter ATP-binding protein YddA (yddA) from Escherichia coli (strain K12)

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 100% identity to eco:b1496)

Predicted SEED Role

"Hypothetical ABC transporter ATP-binding protein yddA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P31826 at UniProt or InterPro

Protein Sequence (561 amino acids)

>b1496 fused predicted multidrug transporter subunits of ABC superfamily: membrane component/ATP-binding component (NCBI) (Escherichia coli BW25113)
MITIPITLRMLIAKYLCLLKPFWLRKNNKTSVLLIIIILAMILGVVKIQVWLNDWNNDFF
NALSQKETDKLWQLVLWFPALLGIFVLISVNKTWLIKLLTIRWREWLTDYYLNRWFADKN
YYFTQIYGEHKNTDNPDQRIAEDILLLISKTLSLSFGFIQSLSMLITFTVILWESAGTLS
FTVGGTEWNIQGYMVYTVVLIVIGGTLFTHKVGKRIRPLNVEKQRSEATFRTNLVQHNKQ
AELIALSNAESLQRQELSDNFHTIKENWHRLMNRQRWLDYWQNIYSRSLSVLPYFLLLPQ
FISGQINLGGLMKSRQAFMLVSNNLSWFIYKYDELAELAAVIDRLYEFHQLTEQRPTNKP
KNCQHAVQVADASIRTPDNKIILENLNFHVSPGKWLLLKGYSGAGKTTLLKTLSHCWPWF
KGDISSPADSWYVSQTPLIKTGLLKEIICKALPLPVDDKSLSEVLHQVGLGKLAARIHDH
DRWGDILSSGEKQRIALARLILRRPKWIFLDETTSHLEEQEAIRLLRLVREKLPTSGVIM
VTHQPGVWNLADDICDISAVL