Protein Info for b1427 in Escherichia coli BW25113

Name: rimL
Annotation: ribosomal-protein-L7/L12-serine acetyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF13302: Acetyltransf_3" amino acids 11 to 150 (140 residues), 82.3 bits, see alignment E=8.3e-27 PF00583: Acetyltransf_1" amino acids 39 to 150 (112 residues), 54.5 bits, see alignment E=2.1e-18 PF13420: Acetyltransf_4" amino acids 59 to 168 (110 residues), 36.5 bits, see alignment E=7.8e-13

Best Hits

Swiss-Prot: 100% identical to RIML_ECOLI: Ribosomal-protein-serine acetyltransferase (rimL) from Escherichia coli (strain K12)

KEGG orthology group: K03817, ribosomal-protein-serine acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to eco:b1427)

MetaCyc: 100% identical to ribosomal-protein-L12-serine N-acetyltransferase (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

"Ribosomal-protein-L7p-serine acetyltransferase" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P13857 at UniProt or InterPro

Protein Sequence (179 amino acids)

>b1427 ribosomal-protein-L7/L12-serine acetyltransferase (NCBI) (Escherichia coli BW25113)
MTETIKVSESLELHAVAENHVKPLYQLICKNKTWLQQSLNWPQFVQSEEDTRKTVQGNVM
LHQRGYAKMFMIFKEDELIGVISFNRIEPLNKTAEIGYWLDESHQGQGIISQALQALIHH
YAQSGELRRFVIKCRVDNPQSNQVALRNGFILEGCLKQAEFLNDAYDDVNLYARIIDSQ