Protein Info for b1398 in Escherichia coli BW25113

Name: paaK
Annotation: phenylacetyl-CoA ligase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR02155: phenylacetate-CoA ligase" amino acids 11 to 432 (422 residues), 790.4 bits, see alignment E=1.6e-242 PF00501: AMP-binding" amino acids 76 to 289 (214 residues), 64.4 bits, see alignment E=8.8e-22 PF14535: AMP-binding_C_2" amino acids 336 to 432 (97 residues), 96.1 bits, see alignment E=1.3e-31

Best Hits

Swiss-Prot: 100% identical to PAAK_ECOLI: Phenylacetate-coenzyme A ligase (paaK) from Escherichia coli (strain K12)

KEGG orthology group: K01912, phenylacetate-CoA ligase [EC: 6.2.1.30] (inferred from 100% identity to eco:b1398)

MetaCyc: 66% identical to phenylacetate-CoA ligase (aerobic) (Aromatoleum evansii)
Phenylacetate--CoA ligase. [EC: 6.2.1.30]

Predicted SEED Role

"Phenylacetate-coenzyme A ligase (EC 6.2.1.30) PaaF" (EC 6.2.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76085 at UniProt or InterPro

Protein Sequence (437 amino acids)

>b1398 phenylacetyl-CoA ligase (NCBI) (Escherichia coli BW25113)
MITNTKLDPIETASVDELQALQTQRLKWTLKHAYENVPMYRRKFDAAGVHPDDFRELSDL
RKFPCTTKQDLRDNYPFDTFAVPMEQVVRIHASSGTTGKPTVVGYTQNDIDNWANIVARS
LRAAGGSPKDKIHVAYGYGLFTGGLGAHYGAERLGATVIPMSGGQTEKQAQLIRDFQPDM
IMVTPSYCLNLIEELERQLGGDASGCSLRVGVFGAEPWTQAMRKEIERRLGITALDIYGL
SEVMGPGVAMECLETTDGPTIWEDHFYPEIVNPHDGTPLADGEHGELLFTTLTKEALPVI
RYRTRDLTRLLPGTARTMRRMDRISGRSDDMLIIRGVNVFPSQLEEEIVKFEHLSPHYQL
EVNRRGHLDSLSVKVELKESSLTLTHEQRCQVCHQLRHRIKSMVGISTDVMIVNCGSIPR
SEGKACRVFDLRNIVGA