Protein Info for b1315 in Escherichia coli BW25113

Name: ycjS
Annotation: predicted oxidoreductase, NADH-binding (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01408: GFO_IDH_MocA" amino acids 10 to 129 (120 residues), 120.9 bits, see alignment E=1e-38 PF03447: NAD_binding_3" amino acids 16 to 125 (110 residues), 28 bits, see alignment E=6.4e-10 PF22725: GFO_IDH_MocA_C3" amino acids 139 to 264 (126 residues), 58.2 bits, see alignment E=1.7e-19 PF02894: GFO_IDH_MocA_C" amino acids 142 to 351 (210 residues), 139.1 bits, see alignment E=3.9e-44

Best Hits

Swiss-Prot: 100% identical to YCJS_ECOLI: Uncharacterized oxidoreductase YcjS (ycjS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1315)

MetaCyc: 100% identical to D-glucoside 3-dehydrogenase (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"Putative oxidoreductase YcjS (EC 1.-.-.-), NADH-binding" in subsystem Maltose and Maltodextrin Utilization (EC 1.-.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P77503 at UniProt or InterPro

Protein Sequence (351 amino acids)

>b1315 predicted oxidoreductase, NADH-binding (NCBI) (Escherichia coli BW25113)
MKSAMTSSPLRVAIIGAGQVADKVHASYYCTRNDLELVAVCDSRLSQAQALAEKYGNASV
WDDPQAMLLAVKPDVVSVCSPNRFHYEHTLMALEAGCHVMCEKPPAMTPEQAREMCDTAR
KLGKVLAYDFHHRFALDTQQLREQVTNGVLGEIYVTTARALRRCGVPGWGVFTNKELQGG
GPLIDIGIHMLDAAMYVLGFPAVKSVNAHSFQKIGTQKSCGQFGEWDPATYSVEDSLFGT
IEFHNGGILWLETSFALNIREQSIMNVSFCGDKAGATLFPAHIYTDNNGELMTLMQREIA
DDNRHLRSMEAFINHVQGKPVMIADAEQGYIIQQLVAALYQSAETGTRVEL