Protein Info for b1311 in Escherichia coli BW25113

Name: ycjO
Annotation: predicted sugar transporter subunit: membrane component of ABC superfamily (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 77 to 98 (22 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 163 to 186 (24 residues), see Phobius details amino acids 210 to 235 (26 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 88 to 280 (193 residues), 83.2 bits, see alignment E=1e-27

Best Hits

Swiss-Prot: 100% identical to YCJO_SHIFL: Inner membrane ABC transporter permease protein YcjO (ycjO) from Shigella flexneri

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to eco:b1311)

Predicted SEED Role

"Inner membrane ABC transporter permease protein YcjO" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFR7 at UniProt or InterPro

Protein Sequence (293 amino acids)

>b1311 predicted sugar transporter subunit: membrane component of ABC superfamily (NCBI) (Escherichia coli BW25113)
MNRLFSGRSDMPFALLLLAPSLLLLGGLVAWPMVSNIEISFLRLPLNPNIESTFVGVSNY
VRILSDPGFWHSLWMTVWYTALVVAGSTVLGLAVAMFFNREFRLRKTARSLVILSYVTPS
ISLVFAWKYMFNNGYGIVNYLGVDLLHLYEQAPLWFDNPGSSFVLVVLFAIWRYFPYAFI
SFLAILQTIDKSLYEAAEMDGANAWQRFRIVTLPAIMPVLATVVTLRTIWMFYMFADVYL
LTTKVDILGVYLYKTAFAFNDLGKAAAISVVLFIIIFAVILLTRKRVNLNGNK