Protein Info for b1308 in Escherichia coli BW25113
Name: pspE
Annotation: thiosulfate:cyanide sulfurtransferase (rhodanese) (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to PSPE_ECOLI: Thiosulfate sulfurtransferase PspE (pspE) from Escherichia coli (strain K12)
KEGG orthology group: K03972, phage shock protein E (inferred from 100% identity to eco:b1308)MetaCyc: 100% identical to thiosulfate sulfurtransferase PspE (Escherichia coli K-12 substr. MG1655)
Thiosulfate--thiol sulfurtransferase. [EC: 2.8.1.3]; Thiosulfate sulfurtransferase. [EC: 2.8.1.3, 2.8.1.1]
Predicted SEED Role
"Phage shock protein E precursor"
MetaCyc Pathways
- thiosulfate disproportionation IV (rhodanese) (1/1 steps found)
- sulfide oxidation IV (mitochondria) (2/5 steps found)
- superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (1/6 steps found)
- superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.8.1.1
Use Curated BLAST to search for 2.8.1.1 or 2.8.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P23857 at UniProt or InterPro
Protein Sequence (104 amino acids)
>b1308 thiosulfate:cyanide sulfurtransferase (rhodanese) (NCBI) (Escherichia coli BW25113) MFKKGLLALALVFSLPVFAAEHWIDVRVPEQYQQEHVQGAINIPLKEVKERIATAVPDKN DTVKVYCNAGRQSGQAKEILSEMGYTHVENAGGLKDIAMPKVKG