Protein Info for b1308 in Escherichia coli BW25113

Name: pspE
Annotation: thiosulfate:cyanide sulfurtransferase (rhodanese) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR02981: phage shock operon rhodanese PspE" amino acids 3 to 103 (101 residues), 209.6 bits, see alignment E=2.8e-67 PF00581: Rhodanese" amino acids 22 to 95 (74 residues), 59.3 bits, see alignment E=2.2e-20

Best Hits

Swiss-Prot: 100% identical to PSPE_ECOLI: Thiosulfate sulfurtransferase PspE (pspE) from Escherichia coli (strain K12)

KEGG orthology group: K03972, phage shock protein E (inferred from 100% identity to eco:b1308)

MetaCyc: 100% identical to thiosulfate sulfurtransferase PspE (Escherichia coli K-12 substr. MG1655)
Thiosulfate--thiol sulfurtransferase. [EC: 2.8.1.3]; Thiosulfate sulfurtransferase. [EC: 2.8.1.3, 2.8.1.1]

Predicted SEED Role

"Phage shock protein E precursor"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1 or 2.8.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P23857 at UniProt or InterPro

Protein Sequence (104 amino acids)

>b1308 thiosulfate:cyanide sulfurtransferase (rhodanese) (NCBI) (Escherichia coli BW25113)
MFKKGLLALALVFSLPVFAAEHWIDVRVPEQYQQEHVQGAINIPLKEVKERIATAVPDKN
DTVKVYCNAGRQSGQAKEILSEMGYTHVENAGGLKDIAMPKVKG