Protein Info for b1271 in Escherichia coli BW25113

Name: yciK
Annotation: short chain dehydrogenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00106: adh_short" amino acids 14 to 209 (196 residues), 187.6 bits, see alignment E=5.3e-59 PF02719: Polysacc_synt_2" amino acids 15 to 183 (169 residues), 21.4 bits, see alignment E=4e-08 PF08659: KR" amino acids 15 to 180 (166 residues), 55.5 bits, see alignment E=2.1e-18 PF13561: adh_short_C2" amino acids 19 to 239 (221 residues), 125.6 bits, see alignment E=7.3e-40 PF23441: SDR" amino acids 84 to 202 (119 residues), 28.7 bits, see alignment E=2.6e-10

Best Hits

Swiss-Prot: 100% identical to YCIK_ECOLI: Uncharacterized oxidoreductase YciK (yciK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b1271)

Predicted SEED Role

"YciK-like oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P31808 at UniProt or InterPro

Protein Sequence (252 amino acids)

>b1271 short chain dehydrogenase (NCBI) (Escherichia coli BW25113)
MHYQPKQDLLNDRIILVTGASDGIGREAAMTYARYGATVILLGRNEEKLRQVASHINEET
GRQPQWFILDLLTCTSENCQQLAQRIAVNYPRLDGVLHNAGLLGDVCPMSEQNPQVWQDV
MQVNVNATFMLTQALLPLLLKSDAGSLVFTSSSVGRQGRANWGAYAASKFATEGMMQVLA
DEYQQRLRVNCINPGGTRTAMRASAFPTEDPQKLKTPADIMPLYLWLMGDDSRRKTGMTF
DAQPGRKPGISQ