Protein Info for b1237 in Escherichia coli BW25113

Name: hns
Annotation: global DNA-binding transcriptional dual regulator H-NS (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 PF22470: Histone_HNS_N" amino acids 1 to 78 (78 residues), 93.3 bits, see alignment E=6.7e-31 PF00816: Histone_HNS" amino acids 95 to 135 (41 residues), 56.9 bits, see alignment E=1.3e-19

Best Hits

Swiss-Prot: 100% identical to HNS_ECO57: DNA-binding protein H-NS (hns) from Escherichia coli O157:H7

KEGG orthology group: K03746, DNA-binding protein H-NS (inferred from 100% identity to eco:b1237)

Predicted SEED Role

"DNA-binding protein H-NS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACF8 at UniProt or InterPro

Protein Sequence (137 amino acids)

>b1237 global DNA-binding transcriptional dual regulator H-NS (NCBI) (Escherichia coli BW25113)
MSEALKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEESAAAAEVEERTRKLQQ
YREMLIADGIDPNELLNSLAAVKSGTKAKRAQRPAKYSYVDENGETKTWTGQGRTPAVIK
KAMDEQGKSLDDFLIKQ