Protein Info for b1209 in Escherichia coli BW25113

Name: lolB
Annotation: outer membrane lipoprotein LolB precursor (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR00548: outer membrane lipoprotein LolB" amino acids 5 to 206 (202 residues), 330.2 bits, see alignment E=2.1e-103 PF03550: LolB" amino acids 50 to 204 (155 residues), 159.8 bits, see alignment E=2.7e-51

Best Hits

Swiss-Prot: 100% identical to LOLB_SHIBS: Outer-membrane lipoprotein LolB (lolB) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K02494, outer membrane lipoprotein LolB (inferred from 100% identity to eco:b1209)

MetaCyc: 100% identical to outer membrane lipoprotein LolB (Escherichia coli K-12 substr. MG1655)
RXN-22553

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P61320 at UniProt or InterPro

Protein Sequence (207 amino acids)

>b1209 outer membrane lipoprotein LolB precursor (NCBI) (Escherichia coli BW25113)
MPLPDFRLIRLLPLAALVLTACSVTTPKGPGKSPDSPQWRQHQQDVRNLNQYQTRGAFAY
ISDQQKVYARFFWQQTGQDRYRLLLTNPLGSTELELNAQPGNVQLVDNKGQRYTADDAEE
MIGKLTGMPIPLNSLRQWILGLPGDATDYKLDDQYRLSEITYSQNGKNWKVVYGGYDTKT
QPAMPANMELTDGGQRIKLKMDNWIVK