Protein Info for b1191 in Escherichia coli BW25113

Name: b1191
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 31 to 53 (23 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 89 to 114 (26 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 185 to 210 (26 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details amino acids 298 to 323 (26 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 20 to 388 (369 residues), 231.2 bits, see alignment E=2.8e-72 PF02080: TrkA_C" amino acids 421 to 483 (63 residues), 41.3 bits, see alignment E=1.8e-14 PF03471: CorC_HlyC" amino acids 494 to 571 (78 residues), 40.2 bits, see alignment E=4.3e-14

Best Hits

Swiss-Prot: 100% identical to NHAP2_ECOLI: K(+)/H(+) antiporter NhaP2 (cvrA) from Escherichia coli (strain K12)

KEGG orthology group: K11105, cell volume regulation protein A (inferred from 100% identity to eco:b1191)

Predicted SEED Role

"Cell volume regulation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76007 at UniProt or InterPro

Protein Sequence (578 amino acids)

>b1191 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQHHE
SNISWMFIVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFSLTTA
LEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIAI
PALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLEN
ARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVYQ
LSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPALG
KLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGAA
PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES