Protein Info for b1091 in Escherichia coli BW25113

Name: fabH
Annotation: 3-oxoacyl-(acyl carrier protein) synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to FABH_ECOLI: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Escherichia coli (strain K12)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 100% identity to eco:b1091)

MetaCyc: 100% identical to 3-oxoacyl-[acyl carrier protein] synthase 3 (Escherichia coli K-12 substr. MG1655)
[Acyl-carrier-protein] S-acetyltransferase. [EC: 2.3.1.38]; Beta-ketoacyl-acyl-carrier-protein synthase III. [EC: 2.3.1.38, 2.3.1.180]

Predicted SEED Role

No annotation

MetaCyc Pathways

superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
superpathway of fatty acid biosynthesis I (E. coli) (16/16 steps found)
superpathway of fatty acid biosynthesis initiation (5/5 steps found)
fatty acid biosynthesis initiation (type II) (3/3 steps found)
fatty acid biosynthesis initiation (mitochondria) (3/4 steps found)
streptorubin B biosynthesis (20/34 steps found)

KEGG Metabolic Maps

Fatty acid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180 or 2.3.1.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A6R0 at UniProt or InterPro

Protein Sequence (317 amino acids)

>b1091 3-oxoacyl-(acyl carrier protein) synthase (NCBI) (Escherichia coli BW25113)
MYTKIIGTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFEAAT
RAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTYALS
VADQYVKSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASEEPGIISTHLH
ADGSYGELLTLPNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNLDRSQLDW
LVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPGQLVL
LEAFGGGFTWGSALVRF