Protein Info for b1082 in Escherichia coli BW25113

Name: flgK
Annotation: flagellar hook-associated protein K (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 TIGR02492: flagellar hook-associated protein FlgK" amino acids 3 to 348 (346 residues), 260.5 bits, see alignment E=1.9e-81 PF00460: Flg_bb_rod" amino acids 5 to 35 (31 residues), 24.3 bits, see alignment (E = 3.7e-09) PF21158: flgK_1st_1" amino acids 336 to 415 (80 residues), 98.5 bits, see alignment E=2.8e-32 PF06429: Flg_bbr_C" amino acids 491 to 546 (56 residues), 27.9 bits, see alignment 3.1e-10

Best Hits

Swiss-Prot: 100% identical to FLGK_ECOLI: Flagellar hook-associated protein 1 (flgK) from Escherichia coli (strain K12)

KEGG orthology group: K02396, flagellar hook-associated protein 1 FlgK (inferred from 100% identity to eco:b1082)

Predicted SEED Role

"Flagellar hook-associated protein FlgK" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P33235 at UniProt or InterPro

Protein Sequence (547 amino acids)

>b1082 flagellar hook-associated protein K (NCBI) (Escherichia coli BW25113)
MSSLINNAMSGLNAAQAALNTASNNISSYNVAGYTRQTTIMAQANSTLGAGGWVGNGVYV
SGVQREYDAFITNQLRAAQTQSSGLTARYEQMSKIDNMLSTSTSSLATQMQDFFTSLQTL
VSNAEDPAARQALIGKSEGLVNQFKTTDQYLRDQDKQVNIAIGASVDQINNYAKQIASLN
DQISRLTGVGAGASPNNLLDQRDQLVSELNQIVGVEVSVQDGGTYNITMANGYSLVQGST
ARQLAAVPSSADPSRTTVAYVDGTAGNIEIPEKLLNTGSLGGILTFRSQDLDQTRNTLGQ
LALAFAEAFNTQHKAGFDANGDAGEDFFAIGKPAVLQNTKNKGDVAIGATVTDASAVLAT
DYKISFDNNQWQVTRLASNTTFTVTPDANGKVAFDGLELTFTGTPAVNDSFTLKPVSDAI
VNMDVLITDEAKIAMASEEDAGDSDNRNGQALLDLQSNSKTVGGAKSFNDAYASLVSDIG
NKTATLKTSSATQGNVVTQLSNQQQSISGVNLDEEYGNLQRFQQYYLANAQVLQTANAIF
DALINIR