Protein Info for b1065 in Escherichia coli BW25113

Name: yceL
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 58 (18 residues), see Phobius details amino acids 78 to 95 (18 residues), see Phobius details amino acids 100 to 116 (17 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 165 to 188 (24 residues), see Phobius details amino acids 210 to 235 (26 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details amino acids 276 to 294 (19 residues), see Phobius details amino acids 300 to 317 (18 residues), see Phobius details amino acids 337 to 357 (21 residues), see Phobius details amino acids 369 to 388 (20 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 238 (219 residues), 89.8 bits, see alignment E=8.8e-30 amino acids 211 to 387 (177 residues), 43.3 bits, see alignment E=1.2e-15

Best Hits

Swiss-Prot: 100% identical to MDTH_ECO81: Multidrug resistance protein MdtH (mdtH) from Escherichia coli O81 (strain ED1a)

KEGG orthology group: K08162, MFS transporter, DHA1 family, multidrug resistance protein (inferred from 100% identity to eco:b1065)

Predicted SEED Role

"MFS superfamily export protein YceL" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P69367 at UniProt or InterPro

Protein Sequence (402 amino acids)

>b1065 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MSRVSQARNLGKYFLLIDNMLVVLGFFVVFPLISIRFVDQMGWAAVMVGIALGLRQFIQQ
GLGIFGGAIADRFGAKPMIVTGMLMRAAGFATMGIAHEPWLLWFSCLLSGLGGTLFDPPR
SALVVKLIRPQQRGRFFSLLMMQDSAGAVIGALLGSWLLQYDFRLVCATGAVLFVLCAAF
NAWLLPAWKLSTVRTPVREGMTRVMRDKRFVTYVLTLAGYYMLAVQVMLMLPIMVNDVAG
APSAVKWMYAIEACLSLTLLYPIARWSEKHFRLEHRLMAGLLIMSLSMMPVGMVSGLQQL
FTLICLFYIGSIIAEPARETLSASLADARARGSYMGFSRLGLAIGGAIGYIGGGWLFDLG
KSAHQPELPWMMLGIIGIFTFLALGWQFSQKRAARRLLERDA