Protein Info for b1033 in Escherichia coli BW25113

Name: ycdW
Annotation: putative dehydrogenase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 PF02826: 2-Hacid_dh_C" amino acids 105 to 277 (173 residues), 154.7 bits, see alignment E=1.7e-49 PF03446: NAD_binding_2" amino acids 138 to 223 (86 residues), 24.7 bits, see alignment E=2.1e-09

Best Hits

Swiss-Prot: 100% identical to GHRA_ECOSE: Glyoxylate/hydroxypyruvate reductase A (ghrA) from Escherichia coli (strain SE11)

KEGG orthology group: K12972, gyoxylate/hydroxypyruvate reductase A [EC: 1.1.1.79 1.1.1.81] (inferred from 100% identity to eco:b1033)

MetaCyc: 100% identical to glyoxylate/hydroxypyruvate reductase A (Escherichia coli K-12 substr. MG1655)
Glyoxylate reductase (NADP(+)). [EC: 1.1.1.79]; 1.1.1.- [EC: 1.1.1.79]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.79 or 1.1.1.81

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75913 at UniProt or InterPro

Protein Sequence (312 amino acids)

>b1033 putative dehydrogenase (VIMSS) (Escherichia coli BW25113)
MDIIFYHPTFDTQWWIEALRKAIPQARVRAWKSGDNDSADYALVWHPPVEMLAGRDLKAV
FALGAGVDSILSKLQAHPEMLNPSVPLFRLEDTGMGEQMQEYAVSQVLHWFRRFDDYRIQ
QNSSHWQPLPEYHREDFTIGILGAGVLGSKVAQSLQTWRFPLRCWSRTRKSWPGVQSFAG
REELSAFLSQCRVLINLLPNTPETVGIINQQLLEKLPDGAYLLNLARGVHVVEDDLLAAL
DSGKVKGAMLDVFNREPLPPESPLWQHPRVTITPHVAAITRPAEAVEYISRTIAQLEKGE
RVCGQVDRARGY