Protein Info for b1024 in Escherichia coli BW25113

Name: ycdS
Annotation: predicted outer membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 807 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR03939: poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA" amino acids 17 to 807 (791 residues), 978.8 bits, see alignment E=1.1e-298 PF21197: PgaA_barrel" amino acids 514 to 807 (294 residues), 460.3 bits, see alignment E=2.5e-142

Best Hits

Swiss-Prot: 100% identical to PGAA_ECO57: Poly-beta-1,6-N-acetyl-D-glucosamine export protein (pgaA) from Escherichia coli O157:H7

KEGG orthology group: K11935, biofilm PGA synthesis protein PgaA (inferred from 100% identity to eco:b1024)

MetaCyc: 100% identical to partially deacetylated poly-beta-1,6-N-acetyl-D-glucosamine export outer membrane porin (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-275

Predicted SEED Role

"Biofilm PGA outer membrane secretin PgaA"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P69434 at UniProt or InterPro

Protein Sequence (807 amino acids)

>b1024 predicted outer membrane protein (NCBI) (Escherichia coli BW25113)
MYSSSRKRCPKTKWALKLLTAAFLAASPAAKSAVNNAYDALIIEARKGNTQPALSWFALK
SALSNNQIADWLQIALWAGQDKQVITVYNRYRHQQLPARGYAAVAVAYRNLQQWQNSLTL
WQKALSLEPQNKDYQRGQILTLADAGHYDTALVKLKQLNSGAPDKANLLAEAYIYKLAGR
HQDELRAMTESLPENASTQQYPTEYVQALRNNQLAAAIDDANLTPDIRADIHAELVRLSF
MPTRSESERYAIADRALAQYAALEILWHDNPDRTAQYQRIQVDHLGALLTRDRYKDVISH
YQRLKKTGQIIPPWGQYWVASAYLKDHQPKKAQSIMTELFYHKETIAPDLSDEELADLFY
SHLESENYPGALTVTQHTINTSPPFLRLMGTPTSIPNDTWLQGHSFLSTVAKYSNDLPQA
EMTARELAYNAPGNQGLRIDYASVLQARGWPRAAENELKKAEVIEPRNINLEVEQAWTAL
TLQEWQQAAVLTHDVVEREPQDPGVVRLKRAVDVHNLAELRIAGSTGIDAEGPDSGKHDV
DLTTIVYSPPLKDNWRGFAGFGYADGQFSEGKGIVRDWLAGVEWRSRNIWLEAEYAERVF
NHEHKPGARLSGWYDFNDNWRIGSQLERLSHRVPLRAMKNGVTGNSAQAYVRWYQNERRK
YGVSWAFTDFSDSNQRHEVSLEGQERIWSSPYLIVDFLPSLYYEQNTEHDTPYYNPIKTF
DIVPAFEASHLLWRSYENSWEQIFSAGVGASWQKHYGTDVVTQLGYGQRISWNDVIDAGA
TLRWEKRPYDGDREHNLYVEFDMTFRF