Protein Info for b0977 in Escherichia coli BW25113

Name: hyaF
Annotation: protein involved in nickel incorporation into hydrogenase-1 proteins (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF04809: HupH_C" amino acids 51 to 139 (89 residues), 29.7 bits, see alignment E=2.4e-11 amino acids 164 to 279 (116 residues), 115.8 bits, see alignment E=5.1e-38

Best Hits

Swiss-Prot: 100% identical to HYAF_ECOLI: Hydrogenase-1 operon protein HyaF (hyaF) from Escherichia coli (strain K12)

KEGG orthology group: K03618, hydrogenase-1 operon protein HyaF (inferred from 100% identity to eco:b0977)

Predicted SEED Role

"Hydrogenase maturation factor HoxQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P19932 at UniProt or InterPro

Protein Sequence (285 amino acids)

>b0977 protein involved in nickel incorporation into hydrogenase-1 proteins (NCBI) (Escherichia coli BW25113)
MSETFFHLLGPGTQPNDDSFSMNPLPITCQVNDEPSMAALEQCAHSPQVIALLNELQHQL
SERQPPLGEVLAVDLLNLNADDRHFINTLLGEGEVSVRIQQADDSESEIQEAIFCGLWRV
RRRRGEKLLEDKLEAGCAPLALWQAATQNLLPTDSLLPPPIDGLMNGLPLAHELLAHVRN
PDAQPHSINLTQLPISEADRLFLSRLCGPGNIQIRTIGYGESYINATGLRHVWHLRCTDT
LKGPLLESYEICPIPEVVLAAPEDLVDSAQRLSEVCQWLAEAAPT