Protein Info for b0960 in Escherichia coli BW25113

Name: b0960
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 717 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 40 to 56 (17 residues), see Phobius details amino acids 64 to 81 (18 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 389 to 409 (21 residues), see Phobius details amino acids 415 to 433 (19 residues), see Phobius details amino acids 440 to 459 (20 residues), see Phobius details amino acids 465 to 482 (18 residues), see Phobius details amino acids 487 to 505 (19 residues), see Phobius details amino acids 509 to 510 (2 residues), see Phobius details amino acids 512 to 532 (21 residues), see Phobius details TIGR01666: TIGR01666 family membrane protein" amino acids 8 to 706 (699 residues), 1262.2 bits, see alignment E=0 TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 8 to 705 (698 residues), 1164.8 bits, see alignment E=0 PF12805: FUSC-like" amino acids 66 to 345 (280 residues), 367.9 bits, see alignment E=4.6e-114 PF04632: FUSC" amino acids 154 to 575 (422 residues), 33.1 bits, see alignment E=4e-12 amino acids 392 to 685 (294 residues), 37.1 bits, see alignment E=2.5e-13 PF13515: FUSC_2" amino acids 405 to 525 (121 residues), 100.4 bits, see alignment E=1.3e-32

Best Hits

Swiss-Prot: 100% identical to YCCS_ECOLI: Inner membrane protein YccS (yccS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0960)

Predicted SEED Role

"Putative efflux (PET) family inner membrane protein YccS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75870 at UniProt or InterPro

Protein Sequence (717 amino acids)

>b0960 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MLSPLLKRYTWNSAWLYYARIFIALCGTTAFPWWLGDVKLTIPLTLGMVAAALTDLDDRL
AGRLRNLIITLFCFFIASASVELLFPWPWLFAIGLTLSTSGFILLGGLGQRYATIAFGAL
LIAIYTMLGTSLYEHWYQQPMYLLAGAVWYNVLTLIGHLLFPVRPLQDNLARCYEQLARY
LELKSRMFDPDIEDQSQAPLYDLALANGLLMATLNQTKLSLLTRLRGDRGQRGTRRTLHY
YFVAQDIHERASSSHIQYQTLREHFRHSDVLFRFQRLMSMQGQACQQLSRCILLRQPYQH
DPHFERAFTHIDAALERMRDNGAPADLLKTLGFLLNNLRAIDAQLATIESEQAQALPHNN
DENELADDSPHGLSDIWLRLSRHFTPESALFRHAVRMSLVLCFGYAIIQITGMHHGYWIL
LTSLFVCQPNYNATRHRLKLRIIGTLVGIAIGIPVLWFVPSLEGQLVLLVITGVLFFAFR
NVQYAHATMFITLLVLLCFNLLGEGFEVALPRVIDTLIGCAIAWAAVSYIWPDWQFRNLP
RMLERATEANCRYLDAILEQYHQGRDNRLAYRIARRDAHNRDAELASVVSNMSSEPNVTP
QIREAAFRLLCLNHTFTSYISALGAHREQLTNPEILAFLDDAVCYVDDALHHQPADEERV
NEALASLKQRMQQLEPRADSKEPLVVQQVGLLIALLPEIGRLQRQITQVPQETPVSA