Protein Info for b0954 in Escherichia coli BW25113

Name: fabA
Annotation: 3-hydroxydecanoyl-ACP dehydratase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01749: beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA
  • amino acids 4 to 172 (169 residues), 324.6 bits, E=6.9e-102
• PF07977: FabA
  • amino acids 29 to 158 (130 residues), 180.7 bits, E=5.4e-58

Best Hits

Swiss-Prot: 100% identical to FABA_ECO8A: 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase (fabA) from Escherichia coli O8 (strain IAI1)

KEGG orthology group: K01716, 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [EC: 4.2.1.60] (inferred from 100% identity to eco:b0954)

MetaCyc: 100% identical to beta-hydroxyacyl-acyl carrier protein dehydratase/isomerase (Escherichia coli K-12 substr. MG1655)
Trans-2-decenoyl-[acyl-carrier-protein] isomerase. [EC: 5.3.3.14]; 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase. [EC: 5.3.3.14, 4.2.1.59]; 4.2.1.59 [EC: 5.3.3.14, 4.2.1.59]

Predicted SEED Role

"3-hydroxyacyl-[acyl-carrier-protein] dehydratase, FabA form (EC 4.2.1.59)" (EC 4.2.1.59)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (20/20 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (16/16 steps found)
• biotin biosynthesis I (15/15 steps found)
• 8-amino-7-oxononanoate biosynthesis I (11/11 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• cis-vaccenate biosynthesis (5/5 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• mycolate biosynthesis (25/205 steps found)
• superpathway of mycolate biosynthesis (26/239 steps found)

KEGG Metabolic Maps

• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.59

Use Curated BLAST to search for 4.2.1.59 or 4.2.1.60 or 5.3.3.14

Sequence Analysis Tools

See P0A6Q3 at UniProt or InterPro

Protein Sequence (172 amino acids)

>b0954 3-hydroxydecanoyl-ACP dehydratase (NCBI) (Escherichia coli BW25113)
MVDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELD
INPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLP
TAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGLFQDTSAF