Protein Info for b0942 in Escherichia coli BW25113

Name: ycbU
Annotation: predicted fimbrial-like adhesin protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00419: Fimbrial" amino acids 31 to 180 (150 residues), 55.7 bits, see alignment E=3.8e-19

Best Hits

Swiss-Prot: 100% identical to YCBU_ECOLI: Uncharacterized fimbrial-like protein YcbU (ycbU) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0942)

Predicted SEED Role

"type 1 fimbrae adaptor subunit FimF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P75859 at UniProt or InterPro

Protein Sequence (180 amino acids)

>b0942 predicted fimbrial-like adhesin protein (NCBI) (Escherichia coli BW25113)
MKKKTIFQCVILFFSILNIHVGMAGPEQVSMHIYGNVVDQGCDVATKSALQNIHIGDFNI
SDFQAANTVSTAADLNIDITGCAAGITGADVLFSGEADTLAPTLLKLTDTGGSGGMATGI
AVQILDAQSQQEIPLNQVQPLTPLKAGDNTLKYQLRYKSTKAGATGGNATAVLYFDLVYQ