Protein Info for b0927 in Escherichia coli BW25113

Name: ycbL
Annotation: predicted metal-binding enzyme (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00753: Lactamase_B
  • amino acids 9 to 192 (184 residues), 142.3 bits, E=1e-45

Best Hits

Swiss-Prot: 100% identical to GLO22_ECOLI: Hydroxyacylglutathione hydrolase GloC (gloC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0927)

MetaCyc: 100% identical to hydroxyacylglutathione hydrolase GloC (Escherichia coli K-12 substr. MG1655)
Hydroxyacylglutathione hydrolase. [EC: 3.1.2.6]

Predicted SEED Role

"Hypothetical metal-binding enzyme, YcbL homolog"

MetaCyc Pathways

• superpathway of methylglyoxal degradation (6/8 steps found)
• methylglyoxal degradation I (2/3 steps found)
• methylglyoxal degradation VIII (2/3 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

See P75849 at UniProt or InterPro

Protein Sequence (215 amino acids)

>b0927 predicted metal-binding enzyme (NCBI) (Escherichia coli BW25113)
MNYRIIPVTAFSQNCSLIWCEQTRLAALVDPGGDAEKIKQEVDDSGLTLMQILLTHGHLD
HVGAAAELAQHYGVPVFGPEKEDEFWLQGLPAQSRMFGLEECQPLTPDRWLNEGDTISIG
NVTLQVLHCPGHTPGHVVFFDDRAKLLISGDVIFKGGVGRSDFPRGDHNQLISSIKDKLL
PLGDDVIFIPGHGPLSTLGYERLHNPFLQDEMPVW