Protein Info for b0915 in Escherichia coli BW25113

Name: lpxK
Annotation: tetraacyldisaccharide 4'-kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02606: LpxK
  • amino acids 13 to 319 (307 residues), 387.5 bits, E=2.5e-120
• TIGR00682: tetraacyldisaccharide 4'-kinase
  • amino acids 19 to 322 (304 residues), 418.1 bits, E=1.1e-129

Best Hits

Swiss-Prot: 100% identical to LPXK_ECOLI: Tetraacyldisaccharide 4'-kinase (lpxK) from Escherichia coli (strain K12)

KEGG orthology group: K00912, tetraacyldisaccharide 4'-kinase [EC: 2.7.1.130] (inferred from 100% identity to eco:b0915)

MetaCyc: 100% identical to tetraacyldisaccharide 4'-kinase (Escherichia coli K-12 substr. MG1655)
Tetraacyldisaccharide 4'-kinase. [EC: 2.7.1.130]

Predicted SEED Role

"Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130)" in subsystem KDO2-Lipid A biosynthesis or Lipopolysaccharide-related cluster in Alphaproteobacteria (EC 2.7.1.130)

MetaCyc Pathways

• superpathway of Kdo₂-lipid A biosynthesis (24/25 steps found)
• superpathway of (Kdo)₂-lipid A biosynthesis (17/17 steps found)
• lipid IV_A biosynthesis (P. gingivalis) (9/9 steps found)
• lipid IV_A biosynthesis (E. coli) (6/6 steps found)
• lipid IV_A biosynthesis (H. pylori) (6/6 steps found)
• lipid IV_A biosynthesis (P. putida) (6/6 steps found)
• lipid IV_A biosynthesis (Vibrio cholerae serogroup O1 El Tor) (6/6 steps found)
• lipid IV_A biosynthesis (generic) (6/6 steps found)
• lipid IV_A biosynthesis (2,3-diamino-2,3-dideoxy-D-glucopyranose-containing) (5/6 steps found)

KEGG Metabolic Maps

• Lipopolysaccharide biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.130

Sequence Analysis Tools

See P27300 at UniProt or InterPro

Protein Sequence (328 amino acids)

>b0915 tetraacyldisaccharide 4'-kinase (NCBI) (Escherichia coli BW25113)
MIEKIWSGESPLWRLLLPLSWLYGLVSGAIRLCYKLKLKRAWRAPVPVVVVGNLTAGGNG
KTPVVVWLVEQLQQRGIRVGVVSRGYGGKAESYPLLLSADTTTAQAGDEPVLIYQRTDAP
VAVSPVRSDAVKAILAQHPDVQIIVTDDGLQHYRLARDVEIVVIDGVRRFGNGWWLPAGP
MRERAGRLKSVDAVIVNGGVPRSGEIPMHLLPGQAVNLRTGTRCDVAQLEHVVAMAGIGH
PPRFFATLKMCGVQPEKCVPLADHQSLNHADVSALVSAGQTLVMTEKDAVKCRAFAEENW
WYLPVDAQLSGDEPAKLLTQLTLLASGN