Protein Info for b0901 in Escherichia coli BW25113

Name: ycaK
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF02525: Flavodoxin_2" amino acids 5 to 178 (174 residues), 137.6 bits, see alignment E=4.6e-44 PF03358: FMN_red" amino acids 6 to 107 (102 residues), 43.3 bits, see alignment E=2.9e-15

Best Hits

Swiss-Prot: 100% identical to YCAK_ECOLI: Uncharacterized NAD(P)H oxidoreductase YcaK (ycaK) from Escherichia coli (strain K12)

KEGG orthology group: K00358, [EC: 1.6.99.-] (inferred from 100% identity to eco:b0901)

Predicted SEED Role

"putative NAD(P)H dehydrogenase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P43340 at UniProt or InterPro

Protein Sequence (196 amino acids)

>b0901 hypothetical protein (NCBI) (Escherichia coli BW25113)
MQSERIYLVWAHPRHDSLTAHIADAIHQRAMERKIQVTELDLYRRNFNPVMTPEDEPDWK
NMDKRYSPEVHQLYSELLEHDTLVVVFPLWWYSFPAMLKGYIDRVWNNGLAYGDGHKLPF
NKVRWVALVGGDKESFVQMGWEKNISDYLKNMCSYLGIEDADVTFLCNTVVFDGEELHAS
YYQSLLSQVRDMVDAL