Protein Info for b0891 in Escherichia coli BW25113
Name: lolA
Annotation: chaperone for lipoproteins (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to LOLA_ECO5E: Outer-membrane lipoprotein carrier protein (lolA) from Escherichia coli O157:H7 (strain EC4115 / EHEC)
KEGG orthology group: K03634, outer membrane lipoprotein carrier protein (inferred from 100% identity to eco:b0891)MetaCyc: 100% identical to outer membrane lipoprotein carrier protein (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Outer membrane lipoprotein carrier protein LolA"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P61316 at UniProt or InterPro
Protein Sequence (203 amino acids)
>b0891 chaperone for lipoproteins (RefSeq) (Escherichia coli BW25113) MKKIAITCALLSSLVASSVWADAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDL WVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSS DWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQN GAVDAAKFTFTPPQGVTVDDQRK